PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_79487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 172aa    MW: 18962.2 Da    PI: 7.5611
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_79487.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB139.21.1e-4339129494
         NF-YB   4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                   q+ +lPianv+rimk vlP  ak+sk+ake++qec++efi+fvt+eas++c+re+rkt+ngdd+++a+ tlG+++y+ +++ yl++yre e
  MLOC_79487.1  39 QEGLLPIANVGRIMKDVLPPAAKVSKHAKEVIQECATEFIGFVTGEASERCRRERRKTVNGDDICHAMKTLGLDNYAGAMRRYLQRYREGE 129
                   7889************************************************************************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-4037133IPR009072Histone-fold
SuperFamilySSF471132.58E-3239138IPR009072Histone-fold
PfamPF008081.1E-2343106IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.9E-147088No hitNo description
PRINTSPR006155.9E-1489107No hitNo description
PRINTSPR006155.9E-14108126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MTNREDFIHF SGFTQQPGRL SLPRAPSTSG SSSGDPNGQE GLLPIANVGR IMKDVLPPAA  60
KVSKHAKEVI QECATEFIGF VTGEASERCR RERRKTVNGD DICHAMKTLG LDNYAGAMRR  120
YLQRYREGEE LTAALNNHSR SPVPPPPDDG MIQIDIWGER SNSRGNEKHG SD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-3639127492Transcription factor HapC (Eurofung)
4g92_B2e-3639127492Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787430.0KM078743.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690868.12e-65PREDICTED: transcriptional activator hap3-like
SwissprotO822483e-42NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM0Z9971e-127M0Z997_HORVD; Uncharacterized protein
STRINGMLOC_79487.11e-127(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-43nuclear factor Y, subunit B5